PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC18072_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 298aa    MW: 33248.8 Da    PI: 5.2351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC18072_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.28.8e-092974346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + + ++   +W ++a++++ g+t  +++  ++ 
      RrC18072_p1 29 KWTAEENKKFENALAFYDKDtpdRWFKVAAMLP-GKTVGDVIKQYRE 74
                     8********************************.******9999986 PP

2Myb_DNA-binding48.61.9e-15141185347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
      RrC18072_p1 141 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 185
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-42475IPR009057Homeodomain-like
PROSITE profilePS512939.5612580IPR017884SANT domain
SMARTSM007172.1E-102678IPR001005SANT/Myb domain
SuperFamilySSF466891.2E-112882IPR009057Homeodomain-like
PfamPF002493.2E-72974IPR001005SANT/Myb domain
CDDcd001674.42E-82975No hitNo description
PROSITE profilePS5129421.845134190IPR017930Myb domain
SuperFamilySSF466891.66E-17136189IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-18137189IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.7E-13138185IPR009057Homeodomain-like
SMARTSM007178.7E-14138188IPR001005SANT/Myb domain
CDDcd001671.69E-11141186No hitNo description
PfamPF002497.8E-13141185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MNRGIEVMSP ATYSETSSNW LFQENRGTKW TAEENKKFEN ALAFYDKDTP DRWFKVAAML  60
PGKTVGDVIK QYRELEEDVS DIEAGLIPIP GYASDSFTLD WGGDDAGNNG FNMNGYYFAT  120
VGGKRGSVAR AAEHERKKGV PWTEEEHRQF LMGLKKYGKG DWRNIARNFV TTRTPTQVAS  180
HAQKYFIRQV NGGKDKRRSS IHDITTVNIP DSLDAAAADT ATANAPCSPP SLGGSQREGS  240
GQWEGQTIYD ETAAAFFNQN TFQETLLGMS STPYMAKLQE QSFLNASQFE SYNAYLQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-172794875RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631946.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-93DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3C4X30.0A0A0D3C4X3_BRAOL; Uncharacterized protein
STRINGBra005139.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.10.0MYB family protein